ELISA Recombinant Prunus persica Non-specific lipid-transfer protein 1

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Allergen Uniprot ID: P81402 Gene Names: N/A Organism: Prunus persica (Peach) (Amygdalus persica) AA Sequence: ITCGQVSSALAPCIPYVRGGGAVPPACCNGIRNVNNLARTTPDRQAACNCLKQLSASVPGVNPNNAAALPGKCGVHIPYKISASTNCATVK Expression Region: 1-91aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 25.2 kDa Alternative Name(s): Allergen Pru p 1 Major allergen Pru p 3 Allergen: Pru p 3 Relevance: Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues. Reference: "Complete amino acid sequence determination of the major allergen of peach (Prunus persica) Pru p 1."Pastorello E.A., Ortolani C., Baroglio C., Pravettoni V., Ispano M., Giuffrida M.G., Fortunato D., Farioli L., Monza M., Napolitano L., Sacco M., Scibola E., Conti A.Biol. Chem. 380:1315-1320(1999) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.