ELISA Recombinant Silene chalcedonica Ribosome-inactivating protein lychnin

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P85101 Gene Names: N/A Organism: Silene chalcedonica (Maltese-cross) (Lychnis chalcedonica) AA Sequence: RPSWTVDSDSAKYSSFLDSLREEFGRGTPKVCNIPVTKKANNDKFVLVNLVLPFNRNTITLAFRASDAYLVGFQDRDSKTNKLRANFFSDEYRALSGKYKSIFTDAEVLAPALPCASTYTDLQNKAGVSREKLSLGVSSLQTAFTAVYGKVFTGKNVAKFALISIQMVAEAARFKYIEDQVINRGMYSSFEAGARITLLENNWSKISEQYHKSCKLGGGQFTEEEMKLGLLLYN Expression Region: 1-234aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 30.1 kDa Alternative Name(s): Relevance: Ribosome-inactivating protein of type 1, inhibits protein synthesis in animal cells. Inhibits cell-free translation in rabbit reticµLocyte lysate system with an IC50 of 0.17 nM. Reference: "Sequence determination of lychnin, a type 1 ribosome-inactivating protein from Lychnis chalcedonica seeds." Chambery A., de Donato A., Bolognesi A., Polito L., Stirpe F., Parente A. Biol. Chem. 387:1261-1266(2006) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.