ELISA Recombinant Pseudomonas aeruginosa Type III export protein PscF(pscF)

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:P95434 Gene Names:pscF Organism:Pseudomonas aerµginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) AA Sequence:AQIFNPNPGNTLDTVANALKEQANAANKDVNDAIKALQGTDNADNPALLAELQHKINKWSVIYNINSTVTRALRDLMQGILQKI Expression Region:2-85aa Sequence Info:FµLl Length of Mature Protein Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:16.6 kDa Alternative Name(s):Pseudomonas secretion protein F Relevance:Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages. Reference:"Structure of the heterotrimeric complex that regµLates type III secretion needle formation." Quinaud M., Ple S., Job V., Contreras-Martel C., Simorre J.P., Attree I., Dessen A. Proc. Natl. Acad. Sci. U.S.A. 104:7803-7808(2007) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Major component of the type III secretion needle structure. Required for cytotoxicity on macrophages. Involvement in disease: SubcellµLar Location:Secreted Protein Families:MxiH/PrgI/YscF family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?pae:PA1719 STRING Database Link:https://string-db.org/network/208964.PA1719 OMIM Database Link: Lead Time Guidance:13-23 business days