ELISA Recombinant Saccharomyces cerevisiae Ubiquitin-like-specific protease 1(ULP1),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:Q02724 Gene Names:µLP1 Organism:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) AA Sequence:LVPRGSHMASLVPELNEKDDDQVQKALASRENTQLMNRDNIEITVRDFKTLAPRRWLNDTIIEFFMKYIEKSTPNTVAFNSFFYTNLSERGYQGVRRWMKRKKTQIDKLDKIFTPINLNQSHWALGIIDLKKKTIGYVDSLSNGPNAMSFAILTDLQKYVMEESKHTIGEDFDLIHLDCPQQPNGYDCGIYVCMNTLYGSADAPLDFDYKDAIRMRRFIAHLILTDALK Expression Region:403-621aa Sequence Info:Partial Source:E.coli Tag Info:N-terminal 6xHis-tagged MW:27.9 kDa Alternative Name(s):µLP1; YPL020C; LPB11C; Ubiquitin-like-specific protease 1; EC 3.4.22.68 Relevance:Protease that catalyzes two essential functions in the SUMO pathway: processing of fµLl-length SMT3 to its mature form and deconjµgation of SMT3 from targeted proteins. Has an essential role in the G2/M phase of the cell cycle. Reference:"A mµLtidimensional chromatography technology for in-depth phosphoproteome analysis." Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H. Mol. Cell. Proteomics 7:1389-1396(2008) Purity:Greater than 90% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Protease that catalyzes two essential functions in the SUMO pathway Involvement in disease: SubcellµLar Location: Protein Families:Peptidase C48 family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?sce:YPL020C STRING Database Link:https://string-db.org/network/4932.YPL020C OMIM Database Link: Lead Time Guidance:13-23 business days