ELISA Recombinant Salmonella typhimurium Invasion protein iagB(iagB)
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P0CL15
Gene Names: iagB
Organism: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
AA Sequence: DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK
Expression Region: 20-160aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 32 kDa
Alternative Name(s):
Relevance:
Reference: "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2."McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., MµLvaney E. Wilson R.K.Nature 413:852-856(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.