ELISA Recombinant Pseudomonas aeruginosa Protease lasA(lasA)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P14789 Gene Names: lasA Organism: Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) AA Sequence: APPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL Expression Region: 237-418aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 36 kDa Alternative Name(s): Staphylolytic protease Relevance: Involved in proteolysis and elastolysis (degradation of the host protein elastin). Has staphylolytic activity (degrades pentaglycine cross-links in cell wall peptidogylcan), preferring Gly-Gly-|-X substrates where X is Ala or Gly (PubMed:11179971). Enhances the elastolytic but not proteolytic activity of elastase (lasB) and elastolytic activity of other proteases (PubMed:2110137). Degradation of host elastin is likely to contribute to the pathogenicity of P.aerµginosa. While either His-317 or His-356 can abstract a proton in the hydrolysis reaction, the same residue performs both functions in a given catalytic cycle, with the other stabilizing the catalytic intermediate Reference: "A substitution at His-120 in the LasA protease of Pseudomonas aerµginosa blocks enzymatic activity without affecting propeptide processing or extracellµLar secretion."Gustin J.K., Kessler E., Ohman D.E.J. Bacteriol. 178:6608-6617(1996) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.