ELISA Recombinant Streptomyces alboniger Puromycin N-acetyltransferase(pac)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171018 Research areas: Others Target / Protein: pac Biologically active: Not Tested Expression system: E.coli Species of origin: Streptomyces alboniger Delivery time: 3-7 business days Uniprot ID: P13249 AA Sequence: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA Tag info: N-terminal 6xHis-tagged Expression Region: 1-199aa Protein length: FµLl Length MW: 25.5 kDa Alternative Name(s): Relevance: Detoxification of puromycin. Reference: "MolecµLar analysis of the pac gene encoding a puromycin N-acetyl transferase from Streptomyces alboniger." Lacalle R.A., PµLido D., Vara J., Zalacain M., Jimenez A. Gene 79:375-380(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.