Skip to Content

ELISA Recombinant Toxoplasma gondii Dense granule protein 1(GRA1)

https://www.anagnostics.com/web/image/product.template/160055/image_1920?unique=b3f4f0f
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P13403 Gene Names: GRA1 Organism: Toxoplasma gondii AA Sequence: AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE Expression Region: 25-190aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 21.9 kDa Alternative Name(s): Major antigen p24 Relevance: Reference: MolecµLar characterization of a 23-kilodalton major antigen secreted by Toxoplasma gondii.Cesbron-Delauw M.-F., Guy B., Torpier G., Pierce R.J., Lenzen G., Cesbron J.Y., Charif H., Lepage P., Darcy F., Lecocq J.-P., Capron A.Proc. Natl. Acad. Sci. U.S.A. 86:7537-7541(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.