ELISA Recombinant Saccharomyces cerevisiae Heat shock protein SSA1 (SSA1),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Cancer Uniprot ID:P10591 Gene Names:SSA1 Organism:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) AA Sequence:ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD Expression Region:443-642aa Sequence Info:Partial Source:E.coli Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged MW:28.3 kDa Alternative Name(s):Heat shock protein YG100 Relevance:May play a role in the transport of polypeptides both across the mitochondrial membranes and into the endoplasmic reticµLum. A functional difference between SSA1 and SSA2 proteins is expected. SSA1 can participate in the ATP-dependent disassembly of clathrin-coated vesicles. Reference:"The reference genome sequence of Saccharomyces cerevisiae: Then and now." Engel S.R., Dietrich F.S., Fisk D.G., Binkley G., Balakrishnan R., Costanzo M.C., Dwight S.S., Hitz B.C., Karra K., Nash R.S., Weng S., Wong E.D., Lloyd P., Skrzypek M.S., Miyasato S.R., Simison M., Cherry J.M. G3 (Bethesda) 4:389-398(2014) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:May play a role in the transport of polypeptides both across the mitochondrial membranes and into the endoplasmic reticµLum. A functional difference between SSA1 and SSA2 proteins is expected. SSA1 can participate in the ATP-dependent disassembly of clathrin-coated vesicles. Involvement in disease: SubcellµLar Location:Cytoplasm, Secreted, cell wall Protein Families:Heat shock protein 70 family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?sce:YAL005C STRING Database Link:https://string-db.org/network/4932.YAL005C OMIM Database Link: Lead Time Guidance:3-7 business days