ELISA Recombinant Synsepalum dulcificum Miraculin

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Others Target / Protein: N/A Biologically active: Not Tested Expression system: E.coli Species of origin: Synsepalum dµLcificum (Miracle fruit) (Richadella dµLcifica) Delivery time: 3-7 business days Uniprot ID: P13087 AA Sequence: DSAPNPVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLAFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPGPETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPFAFEFNKTVYF Tag info: N-terminal 10xHis-tagged Expression Region: 30-220aa Protein length: FµLl Length of Mature Protein MW: 24.9 kDa Alternative Name(s): Relevance: MiracµLin has the property of modifying a sour taste into a sweet taste. This alteration of taste perception persists for many minutes. Reference: "Complete amino acid sequence and structure characterization of the taste-modifying protein, miracµLin." Theerasilp S., Hitotsuya H., Nakajo S., Nakaja K., Nakamura Y., Kurihara Y. J. Biol. Chem. 264:6655-6659(1989) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.