ELISA Recombinant Rhizobium leguminosarum Nitrogenase iron protein(nifH)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P20623 Gene Names: nifH Organism: Rhizobium leguminosarum AA Sequence: MAALRQIAFYGKGGIGKSTTSQNTLAALVDHHVPRIPMIIRIGGYAQ Expression Region: 1-47aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged MW: 35 kDa Alternative Name(s): Nitrogenase Fe protein Nitrogenase component II Nitrogenase reductase Relevance: The key enzymatic reactions in nitrogen fixation are catalyzed by the nitrogenase complex, which has 2 components: the iron protein and the molybdenum-iron protein. Reference: "The nifH promoter region of Rhizobium leguminosarum: nucleotide sequence and promoter elements controlling activation by NifA protein." Roelvink P.W., Harmsen M., van Kammen A., van den Bos R.C. Gene 87:31-36(1990) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.