ELISA Recombinant Spiroplasma citri Spiralin(spi)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P19215 Gene Names: spi Organism: Spiroplasma citri AA Sequence: CNKTESNNLSIVKTIAVPATVATANPKQVTNAEIKTALEANVLKAVQGVVKTATAADFQFDVYQDNKGTSLTTINLEEGNVEVYVQITPAKDKTVVIGETGYIKVTLPKIKVDISGVVIDQQIVEIKAADPKQVTKDELNAVNTYATLASAVLEAIKNKAPNAGASDFEITNNCDAGDYSAQKDVKVTVKAKDESPNISGEFKVNAKVKATLAPPKAG Expression Region: 24-241aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 39 kDa Alternative Name(s): Relevance: Major membrane protein of spiroplasma. Reference: "Organization and nucleotide sequences of the Spiroplasma citri genes for ribosomal protein S2, elongation factor Ts, spiralin, phosphofructokinase, pyruvate kinase, and an unidentified protein."Chevalier C., Saillard C., Bove J.M.J. Bacteriol. 172:2693-2703(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.