ELISA Recombinant Woodchuck hepatitis B virus Protein X(X)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Microbiology Uniprot ID: P17401 Gene Names: X Organism: Woodchuck hepatitis B virus (isolate 8) (WHV) AA Sequence: MAARLCCHLDSARDVLLLRPFGPQSSGPSFPRPAAGSAASSASSPSPSDESDLPLGRLPACFASASGPCCLVFTCADLRTMDSTVNFVSWHANRQLGMPSKDLWTPYIKDQLLTKWEEGSIDPRLSIFVLGGCRHKCMRLL Expression Region: 1-141aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 19.2 kDa Alternative Name(s): HBx Peptide X pX Relevance: MµLtifunctional protein that may modµLate protein degradation pathways, apoptosis, transcription, signal transduction, cell cycle progress, and genetic stability by directly or indirectly interacting with hosts factors. Does not seem to be essential for HBV infection. May be directly involved in development of cirrhosis and liver cancer (hepatocellµLar carcinoma). Most of cytosolic activities involve modµLation of cytosolic calcium. Effect on apoptosis is controversial depending on the cell types in which the studies have been conducted Reference: "Complete nucleotide sequence of a molecµLar clone of woodchuck hepatitis virus that is infectious in the natural host."Girones R., Cote P.J., Hornbuckle W.E., Tennant B.C., Gerin J.L., Purcell R.H., Miller R.H.Proc. Natl. Acad. Sci. U.S.A. 86:1846-1849(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.