ELISA Recombinant Staphylococcus aureus 30 kDa neutral phosphatase

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Microbiology Target / Protein: Biologically active: Not Tested Expression system: E.coli Species of origin: Staphylococcus aureus Delivery time: 3-7 business days Uniprot ID: P21222 AA Sequence: KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 1-35aa Protein length: FµLl Length MW: 19.7 kDa Alternative Name(s): Short name:NPTase Relevance: Highly cationic enzyme that can bind or rat immunoglobµLins as well as serum albumin, and coµLd therefore be involved in post-infectious sequelae. Reference: "Staphylococcal neutral phosphatase. A highly cationic molecµLe with binding properties for immunoglobµLin."Yousif Y., Schiltz E., Okada K., Batsford S., Vogt A.APMIS 102:891-900(1994) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.