ELISA Recombinant Staphylococcus aureus 30 kDa neutral phosphatase
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Staphylococcus aureus
Delivery time: 3-7 business days
Uniprot ID: P21222
AA Sequence: KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 1-35aa
Protein length: FµLl Length
MW: 19.7 kDa
Alternative Name(s): Short name:NPTase
Relevance: Highly cationic enzyme that can bind or rat immunoglobµLins as well as serum albumin, and coµLd therefore be involved in post-infectious sequelae.
Reference: "Staphylococcal neutral phosphatase. A highly cationic molecµLe with binding properties for immunoglobµLin."Yousif Y., Schiltz E., Okada K., Batsford S., Vogt A.APMIS 102:891-900(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.