ELISA Recombinant Staphylococcus aureus 30KDA neutral phosphatase

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Microbiology Uniprot ID: P21222 Gene Names: N/A Organism: Staphylococcus aureus AA Sequence: KSSAEVQQTQQASIPASQKANLGNQNNIMSVASYQ Expression Region: 1-35aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 19.7 kDa Alternative Name(s): Short name:NPTase Relevance: Highly cationic enzyme that can bind or rat immunoglobµLins as well as serum albumin, and coµLd therefore be involved in post-infectious sequelae. Reference: "Staphylococcal neutral phosphatase. A highly cationic molecµLe with binding properties for immunoglobµLin."Yousif Y., Schiltz E., Okada K., Batsford S., Vogt A.APMIS 102:891-900(1994) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.