ELISA Recombinant Zoarces americanus Ice-structuring protein lambda OP-3
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P19606
Gene Names: N/A
Organism: Zoarces americanus (Ocean pout) (Macrozoarces americanus)
AA Sequence: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN
Expression Region: 23-91aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 11.6 kDa
Alternative Name(s): Antifreeze protein lambda OP-3
Relevance: Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity).
Reference: "MµLtiple genes provide the basis for antifreeze protein diversity and dosage in the ocean pout, Macrozoarces americanus."Hew C.-L., Wang N.-C., Joshi S., Fletcher G.L., Scott G.K., Hayes P.H., Buettner B., Davies P.L.J. Biol. Chem. 263:12049-12055(1988)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.