ELISA Recombinant Zoarces americanus Ice-structuring protein lambda OP-3

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P19606 Gene Names: N/A Organism: Zoarces americanus (Ocean pout) (Macrozoarces americanus) AA Sequence: NQSVVATQLIPINTALTLVMMTTRVIYPTGIPAEDIPRLVSMQVNQAVPMGTTLMPDMVKFYCLCAPKN Expression Region: 23-91aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 11.6 kDa Alternative Name(s): Antifreeze protein lambda OP-3 Relevance: Contributes to protect fish blood from freezing at subzero sea water temperatures. Lowers the blood freezing point. Binds to nascent ice crystals and prevents further growth (By similarity). Reference: "MµLtiple genes provide the basis for antifreeze protein diversity and dosage in the ocean pout, Macrozoarces americanus."Hew C.-L., Wang N.-C., Joshi S., Fletcher G.L., Scott G.K., Hayes P.H., Buettner B., Davies P.L.J. Biol. Chem. 263:12049-12055(1988) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.