ELISA Recombinant Potato leafroll virus Major capsid protein (ORF3)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Microbiology Uniprot ID: P17521 Gene Names: ORF3 Organism: Potato leafroll virus (strain Potato/Canada/Rowhani/1979) (PLrV) AA Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK Expression Region: 1-208aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 27.2 kDa Alternative Name(s): Coat protein Short name: CP Relevance: Major capsid protein. Reference: "Identification and characterization of the potato leafroll virus putative coat protein gene."Kawchuk L.M., Martin R.R., Rochon D.M., McPherson J.J. Gen. Virol. 70:783-788(1989) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.