ELISA Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P24478
Gene Names: N/A
Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
AA Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Expression Region: 22-270aa
Sequence Info: FµLl Length
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 43.4 kDa
Alternative Name(s):
Relevance: Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits.
Reference: Cloning and bacterial expression of a gene encoding ribosome-inactivating proteins, karasurin-A and karasurin-C, from Trichosanthes kirilowii var. japonica.Mizukami H., Iida K., Kondo T., Ogihara Y.Biol. Pharm. BµLl. 20:711-713(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.