ELISA Recombinant Trichosanthes kirilowii Ribosome-inactivating protein karasurin-C

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P24478 Gene Names: N/A Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber) AA Sequence: EGDVSFRLSGATSSSYGVFISNLRKALPYERKLYDIPLLRSTLPGSQRYALIHLTNYADETISVAIDVTNVYVMGYRAGDTSYFFNEASATEAAKYVFKDAKRKVTLPYSGNYERLQIAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFETPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA Expression Region: 22-270aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 43.4 kDa Alternative Name(s): Relevance: Abortion-inducing protein. It inactivates eukaryotic 60S ribosomal subunits. Reference: Cloning and bacterial expression of a gene encoding ribosome-inactivating proteins, karasurin-A and karasurin-C, from Trichosanthes kirilowii var. japonica.Mizukami H., Iida K., Kondo T., Ogihara Y.Biol. Pharm. BµLl. 20:711-713(1997) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.