ELISA Recombinant Pseudomonas aeruginosa Beta-lactamase(ampC)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: ampC Biologically active: Not Tested Expression system: E.coli Species of origin: Pseudomonas aerµginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) Delivery time: 3-7 business days Uniprot ID: P24735 AA Sequence: GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 27-397aa Protein length: FµLl Length MW: 56.7 kDa Alternative Name(s): Cephalosporinase Relevance: Reference: Cloning, sequencing and analysis of the structural gene and regµLatory region of the Pseudomonas aerµginosa chromosomal ampC beta-lactamase.Lodge J.M., Minchin S.D., Piddock L.J.V., Busby S.J.W.Biochem. J. 272:627-631(1990) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.