Skip to Content

ELISA Recombinant Rat Regenerating islet-derived protein 3-beta(Reg3b)

https://www.anagnostics.com/web/image/product.template/152909/image_1920?unique=e16ca1f
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P25031 Gene Names: Reg3b Organism: Rattus norvegicus (Rat) AA Sequence: EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG Expression Region: 27-175aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 20.6 kDa Alternative Name(s): Pancreatitis-associated protein 1;Peptide 23REG-2Regenerating islet-derived protein III-beta ;Reg III-beta Relevance: Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues Reference: Messenger RNA sequence and expression of rat pancreatitis-associated protein, a lectin-related protein overexpressed during acute experimental pancreatitis.Iovanna J., Orelle B., Keim V., Dagorn J.-C.J. Biol. Chem. 266:24664-24669(1991) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

907.00 € 907.0 EUR 907.00 €

907.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.