Skip to Content

ELISA Recombinant Salmonella typhimurium Protein PrgJ(PrgJ)

https://www.anagnostics.com/web/image/product.template/156047/image_1920?unique=9b59aed
(0 review)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171018 Research areas: Others Target / Protein: prgJ Biologically active: Not Tested Expression system: E.coli Species of origin: Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) Delivery time: 3-7 business days Uniprot ID: P41785 AA Sequence: MSIATIVPENAVIGQAVNIRSMETDIVSLDDRLLQAFSGSAIATAVDKQTITNRIEDPNLVTDPKELAISQEMISDYNLYVSMVSTLTRKGVGAVETLLRS Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 1-101aa Protein length: FµLl Length MW: 15.9 kDa Alternative Name(s): Relevance: Required for invasion of epithelial cells. Reference: "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2."McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., MµLvaney E. Wilson R.K.Nature 413:852-856(2001) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.