ELISA Recombinant Rabies virus Matrix protein(M)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171018 Research areas: Others Target / Protein: M Biologically active: Not Tested Expression system: E.coli Species of origin: Rabies virus (strain CVS-11) (RABV) Delivery time: 3-7 business days Uniprot ID: P25223 AA Sequence: MNVLRKIVKKCRDEDTQKPSPVSAPPYDDDLWLPPPEYVPLKELTSKKNMRNFCVNGEVKACSPNGYSFRILRHILGSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVGARQCHIQGRIWCINSNSRACQLWSDMSLQTQRSEEDKDSSLLLE Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 1-202aa Protein length: FµLl Length of Mature Protein MW: 28.1 kDa Alternative Name(s): Phosphoprotein M2 Relevance: Plays a major role in assembly and budding of virion. Completely covers the ribonucleoprotein coil and keep it in condensed bµLlet-shaped form. Inhibits viral transcription and stimµLates replication. Plays a major role in early induction of TRAIL-mediated apoptosis in infected neurons Reference: "Comparative sequence analysis of the M gene among rabies virus strains and its expression by recombinant vaccinia virus." Hiramatsu K., Mannen K., Mifune K., Nishizono A., Takita-Sonoda Y. Virus Genes 7:83-88(1993) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.