ELISA Recombinant Tachypleus tridentatus Limulus clotting factor C,partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171018 Research areas: Others Target / Protein: N/A Biologically active: Not Tested Expression system: E.coli Species of origin: Tachypleus tridentatus (Japanese horseshoe crab) Delivery time: 3-7 business days Uniprot ID: P28175 AA Sequence: IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged Expression Region: 763-1019aa Protein length: Partial MW: 33.8 kDa Alternative Name(s): Relevance: This enzyme is closely associated with an endotoxin-sensitive hemolymph coagµLation system which may play important roles in both hemostasis and host defense mechanisms. Its active form catalyzes the activation of factor B. Reference: "Lipopolysaccharide-sensitive serine-protease zymogen (factor C) of horseshoe crab hemocytes. Identification and alignment of proteolytic fragments produced during the activation show that it is a novel type of serine protease." Tokunaga F., Miyata T., Nakamura T., Morita T., Kuma K., Miyata T., Iwanaga S. Eur. J. Biochem. 167:405-416(1987) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.