ELISA Recombinant Saccharum officinarum Sucrose synthase(SUS1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P31925 Gene Names: SUS1 Organism: Saccharum officinarum (Sµgarcane) AA Sequence: ARLDRVKNMTGPVEISGKKARLRELANPVIVAGDHGKESKDRDEAEEQGGFKKMYSLIDDYKFKGHIRLISAQMNRVRNGELYQYICDTKGAFVQPAYEAFRLDCDRVHEVRSAKDRDLPWRPCEIIADGVSGLHIDPYHSDKDADILVNFFDKCNADPSYWDEISQGGQRIYEKYTWKLYSERLMTLTGAYGFWNYVSKLERGDTRYIDMFYALEYP Expression Region: 1-218aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 41.3 kDa Alternative Name(s): Sucrose-UDP glucosyltransferase Relevance: Sucrose-cleaving enzyme that provides UDP-glucose and fructose for various metabolic pathways. Reference: "Amplification and cloning of sµgarcane sucrose synthase cDNA by anchored PCR."Kumar A.S., Moore P.H., Maretzki A.PCR Methods Appl. 2:70-75(1992) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.