ELISA Recombinant Polistes fuscatus Venom allergen 5

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: allergen Uniprot ID: P35780 Gene Names: N/A Organism: Polistes fuscatus (Paper wasp) AA Sequence: VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQGLETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAGGSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNNMQHHYLICNYGPAGNYLGQLPYTKK Expression Region: 1-205aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 28.1 kDa Alternative Name(s): Allergen Pol f V Antigen 5 Relevance: Reference: "Allergens in Hymenoptera venom. XXV: the amino acid sequences of antigen 5 molecµLes and the structural basis of antigenic cross-reactivity." Hoffman D.R. J. Allergy Clin. Immunol. 92:707-716(1993) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.