ELISA Recombinant Rotavirus A Outer capsid protein VP4,partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P35746 Gene Names: N/A Organism: Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A) AA Sequence: ARPNEDIIISKASLWKEVQYNRDIVIRFVFANNIIKAGGLGYKWSEISYKANNYQYTYMRDGVEVVAHTTVSVNGVSVYNYNTGPLPTDFMIRNYDVLKESSFVYVDYWDDSQAFRNMVYVRSLNAELNQVRCEGGHYSFALPVGSWPVMQGGSVILTFDGVTLSTQFTDYVSLNSLRFRFRCAVSEPSFRVTGTRISNLYGLPAANPMGDQQYYEAAGRFSLILLVPSNDDY Expression Region: 247-479aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 31.5 kDa Alternative Name(s): Hemagglutinin Relevance: Spike-forming protein that mediates virion attachment to the host epithelial cell receptors and plays a major role in cell penetration, determination of host range restriction and virµLence. Rotavirus entry into the host cell probably involves mµLtiple sequential contacts between the outer capsid proteins VP4 and VP7, and the cell receptors. According to the considered strain, VP4 seems to essentially target sialic acid and/or the integrin heterodimer ITGA2/ITGB1 Reference: "Amino acid sequence analysis of bovine rotavirus B223 reveals a unique outer capsid protein VP4 and confirms a third bovine VP4 type." Hardy M.E., Gorziglia M., Woode G.N. Virology 191:291-300(1992) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.