ELISA Recombinant Prochlorothrix hollandica Plastocyanin(petE)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: Research Topic: Others Uniprot ID: P50057 Gene Names: petE Organism: Prochlorothrix hollandica AA Sequence: LLLSAAPASAATVQIKMGTDKYAPLYEPKALSISAGDTVEFVMNKVGPHNVIFDKVPAGESAPALSNTKLAIAPGSFYSVTLGTPGTYSFYCTPHRGAGMVGTITVE Expression Region: 25-131aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 27 kDa Alternative Name(s): Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Reference: "NMR solution structure of plastocyanin from the photosynthetic prokaryote, Prochlorothrix hollandica."Babu C.R., Volkman B.F., BµLlerjahn G.S.Biochemistry 38:4988-4995(1999). Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.