Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

https://www.anagnostics.com/web/image/product.template/155055/image_1920?unique=9b59aed
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Microbiology Uniprot ID: P53184 Gene Names: PNC1 Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) AA Sequence: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK Expression Region: 1-216aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 29 kDa Alternative Name(s): Nicotine deamidase Short name: NAMase Relevance: Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regµLates SIR2-mediated silencing and longevity by preventing the accumµLation of intracellµLar nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Reference: "Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1."Ghislain M., Talla E., Francois J.M.Yeast 19:215-224(2002). Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.