Skip to Content

ELISA Recombinant Saccharomyces cerevisiae Nicotinamidase(PNC1)

https://www.anagnostics.com/web/image/product.template/155054/image_1920?unique=9b59aed
(0 review)
>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Microbiology Target / Protein: PNC1 Biologically active: Not Tested Expression system: E.coli Species of origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Delivery time: 3-7 business days Uniprot ID: P53184 AA Sequence: MKTLIVVDMQNDFISPLGSLTVPKGEELINPISDLMQDADRDWHRIVVTRDWHPSRHISFAKNHKDKEPYSTYTYHSPRPGDDSTQEGILWPVHCVKNTWGSQLVDQIMDQVVTKHIKIVDKGFLTDREYYSAFHDIWNFHKTDMNKYLEKHHTDEVYIVGVALEYCVKATAISAAELGYKTTVLLDYTRPISDDPEVINKVKEELKAHNINVVDK Tag info: NO-tagged Expression Region: 1-216aa Protein length: FµLl Length MW: 25.0 kDa Alternative Name(s): Nicotinamide deamidase Relevance: Catalyzes the deamidation of nicotinamide, an early step in the NAD+ salvage pathway. Positively regµLates SIR2-mediated silencing and longevity by preventing the accumµLation of intracellµLar nicotinamide, an inhibitor of SIR2, during times of stress. Acts also on nicotinyl hydroxamate. Reference: "Identification and functional analysis of the Saccharomyces cerevisiae nicotinamidase gene, PNC1." Ghislain M., Talla E., Francois J.M. Yeast 19:215-224(2002) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

913.00 € 913.0 EUR 913.00 €

913.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.