Skip to Content

ELISA Recombinant Toxocara canis 26KDA secreted antigen(TES-26)

https://www.anagnostics.com/web/image/product.template/160053/image_1920?unique=b3f4f0f
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P54190 Gene Names: TES-26 Organism: Toxocara canis (Canine roundworm) AA Sequence: QCMDSASDCAANAGSCFTRPVSQVLQNRCQRTCNTCDCRDEANNCAASINLCQNPTFEPLVRDRCQKTCGLCAGCGFISSGIVPLVVTSAPSRRVSVTFANNVQVNCGNTLTTAQVANQPTVTWEAQPNDRYTLIMVDPDFPSAANGQQGQRLHWWVINIPGNNIAGGTTLAAFQPSTPAANTGVHRYVFLVYRQPAAINSPLLNNLVVQDSERPGFGTTAFATQFNLGSPYAGNFYRSQA Expression Region: 22-262aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 41.9 kDa Alternative Name(s): Toxocara excretory-secretory antigen 26 ;TES-26 Relevance: Binds phosphatidylethanolamine. Reference: An abundant, trans-spliced mRNA from Toxocara canis infective larvae encodes a 26-KDA protein with homology to phosphatidylethanolamine-binding proteins.Gems D., Ferguson C.J., Robertson B.D., Nieves R., Page A.P., Blaxter M.L., Maizels R.M.J. Biol. Chem. 270:18517-18522(1995) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.