ELISA Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P02862 Gene Names: N/A Organism: Triticum aestivum (Wheat) AA Sequence: LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSA Expression Region: 1-37aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 30.8 kDa Alternative Name(s): Relevance: Glutenins are high-molecµLar weight seed storage proteins of wheat endosperm. Thoµght to be responsible for the visco-elastic property of wheat doµgh. Reference: "Identification of barley and wheat cDNA clones related to the high-M-r polypeptides of wheat gluten."Forde J., Forde B.G., Fry R.P., Kreis M., Shewry P.R., Miflin B.J.FEBS Lett. 162:360-366(1983). Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.