ELISA Recombinant Streptococcus pyogenes serotype M5 M protein, serotype 5(emm5)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P02977 Gene Names: emm5 Organism: Streptococcus pyogenes serotype M5 AA Sequence: AVTRGTINDPQRAKEALDKYELENHDLKTKNEGLKTENEGLKTENEGLKTENEGLKTEKKEHEAENDKLKQQRDTLSTQKETLEREVQNTQYNNETLKIKNGDLTKELNKTRQELANKQQESKENEKALNELLEKTVKDKIAKEQENKETIGTLKKILDETVKDKIAKEQENKETIGTLKKILDETVKDKLAKEQKSKQNIGALKQELAKKDEANKISDASRKGLRRDLDASREAKKQLEAEHQKLEEQNKISEASRKGLRRDLDASREAKKQLEAEQQKLEEQNKISEASRKGLRRDLDASREAKKQVEKALEEANSKLAALEKLNKELEESKKLTEKEKAELQAKLEAEAKALKEQLAKQAEELAKLRAGKASDSQTPDTKPGNKAVPGKGQAPQAGTKPNQNKAPMKETKRQLPST Expression Region: 43-461aa Sequence Info: FµLl Length of Mature Protein Source: E.coli Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 52.5 kDa Alternative Name(s): Relevance: This protein is one of the different antigenic serotypes of protein M. Protein M is closely associated with virµLence of the bacterium and can render the organism resistant to phagocytosis. Reference: "Antigenic variation among group A streptococcal M proteins. Nucleotide sequence of the serotype 5 M protein gene and its relationship with genes encoding types 6 and 24 M proteins."Miller L., Gray L., Beachey E., Kehoe M.J. Biol. Chem. 263:5668-5673(1988) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.