ELISA Recombinant Pseudomonas putida Metapyrocatechase(xylE)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P06622 Gene Names: xylE Organism: Pseudomonas putida (Arthrobacter siderocapsµLatus) AA Sequence: MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT Expression Region: 1-307aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged MW: 55.2 kDa Alternative Name(s): CatO2ase Catechol 2,3-dioxygenase Relevance: This protein is involved in the pathway toluene degradation, which is part of Xenobiotic degradation. View all proteins of this organism that are known to be involved in the pathway toluene degradation and in Xenobiotic degradation. Reference: "Chromogenic identification of genetic regµLatory signals in Bacillus subtilis based on expression of a cloned Pseudomonas gene." Zukowski M.M., Gaffney D.F., Speck D., Kauffmann M., Findeli A., Wisecup A., Lecocq J.-P. Proc. Natl. Acad. Sci. U.S.A. 80:1101-1105(1983) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.