ELISA Recombinant Rotavirus A Non-structural glycoprotein 4,partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P08434
Gene Names: N/A
Organism: Rotavirus A (strain RVA/Cow/United States/NCDV-Lincoln/1969/G6P6[1]) (RV-A) (Rotavirus A (strain Nebraska calf diarrhea virus))
AA Sequence: TLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEWENGKNPYEPKEVTAAM
Expression Region: 45-175aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
MW: 20.9 kDa
Alternative Name(s): NCVP5 NS28
Relevance: Involved in virus morphogenesis. Functions as a receptor for the immature double-layered inner capsid particle (ICP) which transiently buds into the lumen of the roµgh endoplasmic reticµLum during viral maturation. Enterotoxin that causes a phospholipase C-dependent elevation of the intracellµLar calcium concentration in host intestinal mucosa cells. Increased concentration of intracellµLar calcium disrupts the cytoskeleton and the tight junctions, raising the paracellµLar permeability. Potentiates chloride ion secretion throµgh a calcium ion-dependent signaling pathway, inducing age-dependent diarrhea. To perform this enterotoxigenic role in vivo, NSP4 is probably released from infected enterocytes in a soluble form capable of diffusing within the intestinal lumen and interacting with the plasma membrane receptors on neighboring epithelial cells. Possible receptors for NSP4 are alpha-1/beta-1 and alpha-2/beta-1 integrin heterodimers
Reference: "Nucleotide sequence of bovine rotavirus genomic segment 10: an RNA encoding the viral nonstructural glycoprotein." Powell K.F.H., Gunn P.R., Bellamy A.R. Nucleic Acids Res. 16:763-763(1988)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.