ELISA Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: P09989
Gene Names: N/A
Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
AA Sequence: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Expression Region: 24-270aa
Sequence Info: FµLl Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 43.1 kDa
Alternative Name(s):
Relevance: Inactivates eukaryotic 60S ribosomal subunits.
Reference: Cloning of trichosanthin cDNA and its expression in Escherichia coli.Shaw P.C., Yung M.H., Zhu R.H., Ho W.K.K., Ng T.B., Yeung H.W.Gene 97:267-272(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.