ELISA Recombinant Streptomyces lividans DNA-binding protein HU 1(hup1)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P0A3H6 Gene Names: hup1 Organism: Streptomyces lividans AA Sequence: MNRSELVAALADRAEVTRKDADAVLAAFAEVVGDIVSKGDEKVTIPGFLTFERTHRAARTARNPQTGEPIQIPAGYSVKVSAGSKLKEAAKGK Expression Region: 1-93aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 36.9 kDa Alternative Name(s): HSl Relevance: Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extre environmental conditions. Reference: Cloning and sequencing of the hup gene encoding the histone-like protein HSl of Streptomyces lividans.Yokoyama E., Doi K., Ogata S.Biochim. Biophys. Acta 1353:103-106(1997) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.