ELISA Recombinant Staphylococcus aureus Toxic shock syndrome toxin-1(tst)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Others Target / Protein: tst Biologically active: Not Tested Expression system: E.coli Species of origin: Staphylococcus aureus Delivery time: 3-7 business days Uniprot ID: P06886 AA Sequence: STNDNIKDLLDWYSSGSDTFTNSEVLDNSLGSMRIKNTDGSISLIIFPSPYYSPAFTKGEKVDLNTKRTKKSQHTSEGTYIHFQISGVTNTEKLPTPIELPLKVKVHGKDSPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYRSSDKTGGYWKITMNDGSTYQSDLSKKFEYNTEKPPINIDEIKTIEAEIN Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 41-234aa Protein length: FµLl Length of Mature Protein MW: 37.9 kDa Alternative Name(s): TSST-1 Relevance: Responsible for the symptoms of toxic shock syndrome. Reference: "The nucleotide and partial amino acid sequence of toxic shock syndrome toxin-1."Blomster-Hautamaa D.A., Kreiswirth B.N., Kornblum J.S., Novick R.P., Schlievert P.M.J. Biol. Chem. 261:15783-15786(1986) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.