ELISA Recombinant Vaccinia virus Protein L1(VACWR088),partial

Quantity:100µg. Other Quantitys are also available. For further information, please contact us. Research Areas:Others Uniprot ID:P07612 Gene Names:VACWR088 Organism:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR)) AA Sequence:GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG Expression Region:2-183aa Sequence Info:Partial Source:E.coli Tag Info:N-terminal 6xHis-tagged MW:24.8 kDa Alternative Name(s):Virion membrane protein M25 Relevance:Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Reference:"Nucleotide sequence of a cluster of early and late genes in a conserved segment of the vaccinia virus genome." Plucienniczak A., Schroeder E., Zettlmeissl G., Streeck R.E. Nucleic Acids Res. 13:985-998(1985) Purity:Greater than 85% as determined by SDS-PAGE. Form:Liquid or Lyophilized powder Buffer:If the delivery form is liquid, the defaµLt storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Reconstitution:We recommend that this vial be briefly centrifµged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our defaµLt final concentration of glycerol is 50%. Customers coµLd use it as reference. Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. Function:Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex (EFC). Needed for fusion and penetration of the virus core into host cell. Involvement in disease: SubcellµLar Location:Virion membrane, Single-pass membrane protein Protein Families:Chordopoxvirinae L1 family Tissue Specificity: Paythway: HGNC Database Link: UniGene Database Link: KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?vg:3707544 STRING Database Link: OMIM Database Link: Lead Time Guidance:3-7 business days