ELISA Recombinant Spinacia oleracea Plastocyanin,chloroplastic(PETE),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: P00289 Gene Names: PETE Organism: Spinacia oleracea (Spinach) AA Sequence: VEVLLGGGDGSLAFLPGDFSVASGEEIVFKNNAGFPHNVVFDEDEIPSGVDAAKISMSEEDLLNAPGETYKVTLTEKGTYKFYCSPHQGAGMVGKVTVN Expression Region: 70-168aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 26.4 kDa Alternative Name(s): Relevance: Participates in electron transfer between P700 and the cytochrome b6-f complex in photosystem I. Reference: "Plastocyanin is encoded by an uninterrupted nuclear gene in spinach." Rother C., Jansen T., Tyagi A., Tittgen J., Herrmann R.G. Curr. Genet. 11:171-176(1986) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.