ELISA Recombinant Rabies virus Glycoprotein G(G), partial

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: Others Target / Protein: G Biologically active: Not Tested Expression system: E.coli Species of origin: Rabies virus (strain PM) (RABV) Delivery time: 3-7 business days Uniprot ID: P03524 AA Sequence: KFPIYTILDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYILAIKMNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYRWLRTVKTTKESLVIISPSVADLDPYDRSLHSRVFPSGKCSGVAVSSTYCSTNHDYTIWMPENPRLGMSCDIFTNSRGKRASKGSETCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSNETKWCPPDQLVNLHDFRSDEIEHLVVEELVRKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEILPSKGCLRVGGRCHPHVNGVFFNGIILGPDGNVLIPEMQSSLLQQHMELLESSVIPLVHPLADPSTVFKDGDEAEDFVEVHLPDVHNQVSGVDLGLPNWGKY Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 20-459aa Protein length: Partial MW: 65.5 kDa Alternative Name(s): Relevance: Attaches the virus to host cellµLar receptor, inducing endocytosis of the virion. In the endosome, the acidic pH induces conformational changes in the glycoprotein trimer, which trigger fusion between virus and cell mbrane. There is convincing in vitro evidence that the muscµLar form of the nicotinic acetylcholine receptor (nAChR), the neuronal cell adhesion molecµLe (NCAM), and the p75 neurotrophin receptor (p75NTR) bind glycoprotein and thereby facilitate rabies virus entry into cells. Reference: Structure of the glycoprotein gene in rabies virus.Anilionis A., Wunner W.H., Curtis P.J.Nature 294:275-278(1981) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.