ELISA Recombinant Sulfolobus islandicus Chromatin protein Cren7(creN7)

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: C3MPN0 Gene Names: creN7 Organism: SµLfolobus islandicus (strain L.S.2.15 / Lassen #1) AA Sequence: MSSGKKAVKVKTPAGKEAELVPEKVWALAPKGRKGVKIGLFKDPETGKYFRHKLPDDYPI Expression Region: 1-60aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal GST-tagged MW: 33.6 kDa Alternative Name(s): Relevance: A probable chromatin protein, binds double-strand DNA without sequence specificity. Constrains negative DNA supercoils. Reference: Biogeography of the SµLfolobus islandicus pan-genome.Reno M.L., Held N.L., Fields C.J., Burke P.V., Whitaker R.J.Proc. Natl. Acad. Sci. U.S.A. 106:8605-8610(2009) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.