ELISA Recombinant Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20171228 Research areas: Others Target / Protein: N/A Biologically active: Not Tested Expression system: E.coli Species of origin: Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae) Delivery time: 3-7 business days Uniprot ID: O02380 AA Sequence: GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVKP Tag info: N-terminal 6xHis-tagged Expression Region: 16-141aa Protein length: FµLl Length of Mature Protein MW: 17.3 kDa Alternative Name(s): Allergen: Typ p 2 Relevance: Reference: "Cloning and characterisation of a group II allergen from the dust mite Tyrophagus putrescentiae." Eriksson T.L.J., Johansson E., Whitley P., Schmidt M., Elsayed S., van Hage-Hamsten M. Eur. J. Biochem. 251:443-447(1998) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.