ELISA Recombinant Taraxacum officinale Root allergen protein

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: allergen Target / Protein: Biologically active: Not Tested Expression system: E.coli Species of origin: Taraxacum officinale (Common dandelion) (Leontodon taraxacum) Delivery time: 3-7 business days Uniprot ID: O49065 AA Sequence: MAVAEFEITSSLSPSNIFKAFVIDFDTIAPKAEPETYKSIKTIEGDGGVGTIKSITYSDGVPFTSSKHKVDAIDSNNFSISYTIFEGDVLMGIIESGTHHLKFLPSADGGSVYKHSMVFKCKGDAKLTDENVSLMKEGLKKTFKAIETYVISHPEAC Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Expression Region: 1-157aa Protein length: FµLl Length MW: 37 kDa Alternative Name(s): Relevance: Reference: Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.