ELISA Recombinant Saccharomyces cerevisiae Ubiquitin-like protein SMT3(SMT3)

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170405 Research areas: Others Target / Protein: SMT3 Biologically active: Not Tested Expression system: E.coli Species of origin: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Delivery time: 3-7 business days Uniprot ID: Q12306 AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 2-98aa Protein length: FµLl Length MW: 27.1 kDa Alternative Name(s): Relevance: Not known; suppressor of MIF2 mutations. Reference: µLp1-SUMO crystal structure and genetic analysis reveal conserved interactions and a regµLatory element essential for cell growth in yeast.Mossessova E., Lima C.D.Mol. Cell 5:865-876(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.