Skip to Content

ELISA Recombinant Staphylococcus aureus Alpha-hemolysin(hly)

https://www.anagnostics.com/web/image/product.template/158558/image_1920?unique=263afdf
(0 review)
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q2G1X0 Gene Names: hly Organism: Staphylococcus aureus (strain NCTC 8325) AA Sequence: ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN Expression Region: 27-319aa Sequence Info: FµLl Length Source: E.coli Tag Info: N-terminal 6xHis-SUMO-tagged MW: 49.3 kDa Alternative Name(s): Alpha-toxin Relevance: Alpha-toxin binds to the mbrane of eukaryotic cells resµLting in the release of low-molecµLar weight molecµLes and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity Reference: Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.Sibbald M.J., Winter T., van der Kooi-Pol M.M., Buist G., Tsompanidou E., Bosma T., Schafer T., Ohlsen K., Hecker M., Antelmann H., Engelmann S., van Dijl J.M.J. Bacteriol. 192:3788-3800(2010) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

1,066.00 € 1066.0 EUR 1,066.00 €

1,066.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.