ELISA Recombinant Rat Zinc transporter ZIP13(Slc39a13),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q2M1K6
Gene Names: Slc39a13
Organism: Rattus norvegicus (Rat)
AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA
Expression Region: 130-233aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-GST-tagged
MW: 41.2 kDa
Alternative Name(s): Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ;ZIP-13
Relevance: Acts as a zinc-influx transporter.
Reference: "The status, quality, and expansion of the NIH fµLl-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.