ELISA Recombinant Rat Zinc transporter ZIP13(Slc39a13),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q2M1K6 Gene Names: Slc39a13 Organism: Rattus norvegicus (Rat) AA Sequence: WAYTCNISPGVEGQSLQRQQQLGLWVIAGFLTFLALEKMFLNCKEEDPSQAPSKDPTAAALNGGHCLAQPAAEPGLRAVVRNLKVSGYLNLLANTIDNFTHGLA Expression Region: 130-233aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 6xHis-GST-tagged MW: 41.2 kDa Alternative Name(s): Solute carrier family 39 member 13Zrt- and Irt-like protein 13 ;ZIP-13 Relevance: Acts as a zinc-influx transporter. Reference: "The status, quality, and expansion of the NIH fµLl-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.