ELISA Recombinant Pongo pygmaeus Phospholipid hydroperoxide glutathione peroxidase, mitochondrial(GPX4),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q4AEH2
Gene Names: GPX4
Organism: ongo pygmaeus (Bornean orangutan)
AA Sequence: MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQµgKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI
Expression Region: 1-170aa
Sequence Info: Cytoplasmic Domain
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 35 kDa
Alternative Name(s): Glutathione peroxidase 4 Short name:GPx-4 Short name:GSHPx-4
Relevance: CoµLd play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage
Reference: "Structure, gene expression, and evolution of primate glutathione peroxidases."Fukuhara R., Kageyama T.Comp. Biochem. Physiol. 141B:428-436(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.