ELISA Recombinant Triticum aestivum Trypsin-alpha-amylase inhibitor CMx2

>Several Other Quantitys Are Also Available. Please Inquire. DefaµLt Quantity: 200µg Updated Date: Stock Protein updated on 20170725 Research areas: others Target / Protein: Biologically active: Not Tested Expression system: E.coli Species of origin: Triticum aestivum (Wheat) Delivery time: 3-7 business days Uniprot ID: Q43691 AA Sequence: FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKDSLLQDMSRCKKLTREFIAGIVGRE Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged Expression Region: 25-121aa Protein length: FµLl Length of Mature Protein MW: 31.5 kDa Alternative Name(s): ITRL-2 Relevance: Reference: "Sharp divergence between wheat and barley at loci encoding novel members of the trypsin/alpha-amylase inhibitors family." Sanchez de la Hoz P., Castagnaro A., Carbonero P. Plant Mol. Biol. 26:1231-1236(1994) Purity: Greater than 85% as determined by SDS-PAGE. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.