ELISA Recombinant Staphylococcus aureus Tetracycline resistance protein tetM(tetM),partial
Quantity: 200µg. Other Quantitys are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q53770
Gene Names: tetM
Organism: Staphylococcus aureus
AA Sequence: MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDFVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKSNIGIDNLIEVITNKFYSST
Expression Region: 1-242aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 32.1 kDa
Alternative Name(s): tetA(M)
Relevance: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
Reference: "Cloning and nucleotide sequence of a chromosomally encoded tetracycline resistance determinant, tetA(M), from a pathogenic, methicillin-resistant strain of Staphylococcus aureus." Nesin M., Svec P., Lupski J.R., Godson G.N., Kreiswirth B., Projan S.J. Antimicrob. Agents Chemother. 34:2273-2276(1990)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.