ELISA Recombinant Staphylococcus aureus Tetracycline resistance protein tetM(tetM),partial

Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Others Uniprot ID: Q53770 Gene Names: tetM Organism: Staphylococcus aureus AA Sequence: MKIINIGVLAHVDAGKTTLTESLLYNSGAITELGSVDKGTTRTDNTLLERQRGITIQTGITSFQWENTKVNIIDTPGHMDFLAEVYRSLSVLDGAILLISAKDFVQAQTRILFHALRKMGIPTIFFINKIDQNGIDLSTVYQDIKEKLSAEIVIKQKVELYPNMCVTNFTESEQWDTVIEGNDDLLEKYMSGKSLEALELEQEESIRFQNCSLFPLYHGSAKSNIGIDNLIEVITNKFYSST Expression Region: 1-242aa Sequence Info: Partial Source: E.coli Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged MW: 32.1 kDa Alternative Name(s): tetA(M) Relevance: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes. Reference: "Cloning and nucleotide sequence of a chromosomally encoded tetracycline resistance determinant, tetA(M), from a pathogenic, methicillin-resistant strain of Staphylococcus aureus." Nesin M., Svec P., Lupski J.R., Godson G.N., Kreiswirth B., Projan S.J. Antimicrob. Agents Chemother. 34:2273-2276(1990) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.